1. Notes: 231 / 3 months ago  from futurejournalismproject (originally from the-houxbois-academy-deactivate)

    futurejournalismproject:

    Via kenyatta:

    The Girl With The Dragon Tattoo (2011) vs Ghost in the Shell (1995)

    The FJP (I pronounce that like ‘The Wu’) posted Rob G. Wilson and Kirby Ferguson’s “Everything is a Remix: The Matrix” earlier today which shows how much of the iconic imagery of The Matrix was created by aping scenes from the classic 1995 anime Ghost in the Shell.

    Also, I just posted a photoset about how the classic Fritz Lang film ‘Metropolis’ actually owed it’s signature look to an earlier Russian film, Aelita.

    Similarly, the visually striking title sequence to David Fincher’s ‘The Girl With The Dragon Tattoo’ seems to also owe much to the opening credits of Ghost in the Shell when placed alongside each other in the photoset above.

    All of this serves to remake Kirby Ferguson’s point with his ‘Everything is a Remix’ series: while established content IP holders like to treat remix as near piracy, mimicry has always existed (good thing) but without attribution (bad thing), especially among Hollywood’s own practitioners.

    So let’s move the ball forward. What if instead of considering any of these examples ‘ripoffs’, we treated this imagery (the framing of a shot, the pace of movement) the same way that hip hop treats samples and beats?

    If the imagery is effective in conveying a particular thought or emotion, why not allow that as a building block of ‘content’?

    FJP: Agreed. Where do we sign up?

  2. Notes

    1. turbochick reblogged this from ellobofilipino
    2. itz-giological reblogged this from ellobofilipino
    3. pilipilikolang reblogged this from ellobofilipino
    4. indierockforthemerfolk reblogged this from niaface
    5. niaface reblogged this from vagabondaesthetics
    6. vagabondaesthetics reblogged this from ellobofilipino
    7. ellobofilipino reblogged this from futurejournalismproject and added:
      Got a copy of Ghost In The Shell. Now all I need is a copy of Girl With The Dragon Tattoo to see these similarities for...
    8. dlightfulchaos reblogged this from kenyatta
    9. welshen reblogged this from peanutsandart
    10. standbycuetinyturtle reblogged this from thingsbox
    11. dirgefunkrecords reblogged this from delete-y0urself
    12. salmonderio reblogged this from delete-y0urself
    13. delete-y0urself reblogged this from solocaos
    14. blurblurblurbb reblogged this from hcdragon
    15. prothytheprothean reblogged this from hcdragon
    16. solocaos reblogged this from hcdragon
avatar_128
 
 
 
 

Following

inothernewseschergirlssupervillaingetoutoftherecatmichaelk42whitewhinetheatlanticfuckyeahnerdpr0ndecemberpaladinblackfolksmakingcomicsmercurialblondealbinwonderlandkeaneoncomicsbettyfelonnationalpostxombiedirgealeatoirecartoonretrocloudjunkycameroncallahanbornofanatombombinstantjoyalexds1thepunkhippicarbonmadepoopbirdwilwheatonkateordiebrianwoodfueledbywhiskypolyanomalybigbigtrucktwentypercentcoolerkochalkaerikamoenhardcoreadvocatemistahgrundyglassgearskatsuyateradabeatonnahan2000adonlineagentmlovestacosgailsimoneeddieatthegovreadingisthenewsexyworsethandetroitdan-hillbrokentvbillcorbettsamriedelkellysuemeowmeowmarudennisculverjoekeatingewarrenellisartcreepnotevensurewhytinfoilandteamattdemersmotherjonesarcaneimagesphilnotokickstarterantistigmacafifflemomentofellisunhappyhipsterscombatbrodomdoctorwholeslearaymondconlonichbinbrittanicaatari-teenage-riotareasofmyexpertiseswegenerrufusdaygloanniewuministryoftruthfilmratingsmisspixnmix3lizafloketthreewordphrasejephjacquesanoncentralseastrawberrycharactermodelhemaniscoolmnemovoreapathyangelscared-shitlessitsfullofstarslittlefroggiesastragoblinchipperwhaledeadline-is-overratedliquidnightdovrynmistahphilrobotsexxxjamesurbaniakkrizkotvchris-gravesusedbandaidresistinginertiawordcorerichbarrettadoctorworldfuckyeahhstmollycrabapplekitsunecaligaritherealkatiewesttoastyghosthello-zombiedarthnikonstoyaperiscopestudioloafabreadsofabedclaytoncubittjohnnytomorrowjessnevinspushartfuturejournalismprojectwntrmutezdarskynaranzarianindiecomicstedcrolandpaintednumbers1187hunterwasserxplanesancientforeveralltheghostsre-lwomen-centric-comicsmilonogianniscriminalwisdomboohooboomckelviecomicbooksfyeahartstudentowlmarksablem1k3ykolbisneatburningfpwilliactheimpossiblecoolbankshotabigaillarsonlivelymorguevornaskottisarahtrotskysequentially-yoursidwcomicsrufftoonvsatonechaselisbonjoylessbutcherlepastsparksheyitsaprilcharlie-twistalliancejournaldavepressmeliorategunshowcomicbrinnyartglukkakesquirm-whaleicelandbobfedalovesketchyjoedeantrippejessfinktickledfancyhawkstudiosandrewmacleanjohnskylartemplesmithfyeaharttipschristiansagersarabenincasadiplopicdresdencodaksansmithlissahasageekgasmmaisonimmonenelosonickmillerladiesmakingcomicsexquisitebeastmidnitesurpriseprinpanlackadaisycatsrazorcapnswingyouranonnewsjnadigernatazillathemorphhellomullerchoochoobeargreenstatecomiccharmworldofstouttapiocanaiflucbernardprobertsonzuerstreinventionoftheprintingpressihatemyparentscarolinemartinnnnnngwelfleneedsmorecoffeefrazettacancercellsinclesstitsnasswhosnametexturemusickbettiebreitweiserdeploymechsbeckycloonannatecosboomrnfoxmutantmagicfuck-no-greg-landaidosaurbrandnewnostalgialivefromthedmzfuckyeahhungarycarbonprodtnperkinshmobiusfuckyeahconsciousnessdanieldieneltstudiolexmachinamrhippoutinthewastesaljazeerayourdarkesthourtwitterstatuslainieyeohlessigsteinlotheairtightgaragethepallidbustofpallashaverholmckboddyjustinrampageloishellynmeitentacularonebritishchickfuckyeahgeekgirlspusheenofficialbeastieboysmonstrusshamscamdwichkittyrightsactivistsdrfooafuasketchnew-aestheticbillfutrealjason941494super-villianbourbonthretwearethe99percentcmdrrikermalsainscameron-stewarttherovingeyemeprestaagdmamberreckercaptainscorpiowomanthologyensignaucunchryanpequintrini-naenaecliffchiangrebeccasugargraphitemindmomentofmooretousledelegancejhonenvcastlecastlecomicpinkoftheinkluuhowladiesmakingcomixxxsexyfawkesmikesterotomblrbumtickleyandyvsalexandrenavarroprofessorkadamamebeanrepublicandalek
 

Tumblr